PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016472695.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 608aa    MW: 68513.3 Da    PI: 9.6509
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016472695.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B343.45.9e-1427116198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+    + ++++rl++p +fa+++ ++  ++  + le +sg++Wev++    ++gr+ l+ GW++F +   +  gDf++F ++ rs f  +v+
  XP_016472695.1  27 FFKII--LSQHERSRLRIPEDFASRYCKNMLNP--VYLEVPSGEVWEVEV--VHSQGRICLGIGWQDFSDFYSISCGDFLMFGYNARSHF--NVT 113
                     67777..78889999***********5454444..***************..999999**************************999999..999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  XP_016472695.1 114 IFD 116
                     987 PP

2B344.82.3e-14348426587
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     + ps+v+k  +l ++  fa+++  ++e++  l+l+ +s  sW+vk+ + +++    ++ +Wk Fv +n+Lk gD++vF+l++ 
  XP_016472695.1 348 MQPSYVSKPYNLHISFLFARKYF-PEECG-NLVLRVPSRGSWTVKYVVGRSK--AEIRFCWKAFVLDNKLKFGDVCVFELIKG 426
                     67999****99***********7.33454.9***************555555..558999*******************9864 PP

3B3512.5e-16511598595
                     -..-HHHHT...T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   5 ltpsdvlks...grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     + ps+v++     rl++  + a+++     ++ +++l+ +s +sW vk+i   ++    lt+GWk+Fv +n+Lk+gD++vF++++rs+   ++ 
  XP_016472695.1 511 MQPSYVSSAcgpMRLSITLSRARKFFAT--RHSDVVLQVSSKKSWAVKCIL--GPANAKLTSGWKDFVLDNNLKVGDVCVFERVSRSKL--LFN 598
                     4445555557667999999999999755..4558***************55..555566***********************7766555..444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.8E-2019118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-1921118IPR015300DNA-binding pseudobarrel domain
CDDcd100172.43E-1325116No hitNo description
PROSITE profilePS5086312.09725118IPR003340B3 DNA binding domain
PfamPF023621.6E-1027116IPR003340B3 DNA binding domain
SMARTSM010195.5E-1028118IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.4E-19336427IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.88E-19337427IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.7E-9343434IPR003340B3 DNA binding domain
PROSITE profilePS5086310.588344439IPR003340B3 DNA binding domain
CDDcd100175.74E-16348427No hitNo description
PfamPF023624.1E-12348426IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-22499602IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.09E-20500602IPR015300DNA-binding pseudobarrel domain
CDDcd100179.71E-17505602No hitNo description
SMARTSM010194.7E-10507600IPR003340B3 DNA binding domain
PROSITE profilePS5086312.308510605IPR003340B3 DNA binding domain
PfamPF023622.7E-14510597IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MAAKPHLQSG EGSSHWKSST NITQPKFFKI ILSQHERSRL RIPEDFASRY CKNMLNPVYL  60
EVPSGEVWEV EVVHSQGRIC LGIGWQDFSD FYSISCGDFL MFGYNARSHF NVTIFDLSAS  120
EIEYPYSSVH GIHTPISYCH ETRHAPKRDQ SGSDDSVEIL EGIPRSQKAK AKIPDTVEHS  180
VENLGQCPLG QSSKRKRQKG DAEHDASVDM HVKRMKVEKL QEDVASPSFI REGQNHGEGT  240
EIEHSLEILD HCPSGHGSKR KGLEGDAEDD VSTDIHTRSI KVEKSRENVA SPSFTRKTKK  300
SGESCRMHKQ QSKLVSAKNK TVLEKKRSIA YQRARAFKSE NPFVIYFMQP SYVSKPYNLH  360
ISFLFARKYF PEECGNLVLR VPSRGSWTVK YVVGRSKAEI RFCWKAFVLD NKLKFGDVCV  420
FELIKGTKPI LDATIFPAAE SKAKHKIDGK LPDVSDCKNK IIKTENSEDA GKHVQQSKSS  480
CKGRVVAKEM VIAYQRAKAF KSENPFFVCF MQPSYVSSAC GPMRLSITLS RARKFFATRH  540
SDVVLQVSSK KSWAVKCILG PANAKLTSGW KDFVLDNNLK VGDVCVFERV SRSKLLFNVI  600
IYTSAEGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1531660618144B3 domain-containing transcription factor VRN
4i1k_B2e-1531660618144B3 domain-containing transcription factor VRN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1194215RKRQKGDAEHDASVDMHVKRMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016472695.10.0PREDICTED: B3 domain-containing protein LOC_Os12g40080-like isoform X4
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.14e-18B3 family protein